Lineage for d3e7ab_ (3e7a B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046630Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1046631Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1046689Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1046710Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1046711Species Human (Homo sapiens) [TaxId:9606] [188651] (2 PDB entries)
  8. 1046713Domain d3e7ab_: 3e7a B: [174710]
    automated match to d1fjma_
    complexed with azi, cl, gol, iod, mn

Details for d3e7ab_

PDB Entry: 3e7a (more details), 1.63 Å

PDB Description: crystal structure of protein phosphatase-1 bound to the natural toxin nodularin-r
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3e7ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7ab_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d3e7ab_:

Click to download the PDB-style file with coordinates for d3e7ab_.
(The format of our PDB-style files is described here.)

Timeline for d3e7ab_: