SCOPe 2.07: Domain d3e5ha1: 3e5h A:11-183

Lineage for d3e5ha1 (3e5h A:11-183)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d3e5ha1: 3e5h A:11-183 [174671]
   Other proteins in same PDB: d3e5ha2
   automated match to d1d5ca_
   complexed with gnp, gol, mg

Details for d3e5ha1

PDB Entry: 3e5h, 1.5 Å

PDB Description: crystal structure of rab28 gtpase in the active (gppnhp-bound) form

PDB Compounds: (A:) Ras-related protein Rab-28

SCOPe Domain Sequences for d3e5ha1:

Sequence; same for both SEQRES and ATOM records:

>d3e5ha1 c.37.1.0 (A:11-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqiwdig
gqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplvalvgnk
idlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgikln

Timeline for d3e5ha1:

• d3e5ha1 first appeared in SCOPe 2.01, called d3e5ha_
  
• d3e5ha1 appears in SCOPe 2.06
  
• d3e5ha1 appears in the current release, SCOPe 2.08