Lineage for d3dxhb_ (3dxh B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635085Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1635454Protein automated matches [190061] (6 species)
    not a true protein
  7. 1635457Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries)
  8. 1635469Domain d3dxhb_: 3dxh B: [174326]
    automated match to d1a2wa_
    complexed with udp

Details for d3dxhb_

PDB Entry: 3dxh (more details), 1.4 Å

PDB Description: ribonuclease a uridine 5' diphosphate complex
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3dxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxhb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3dxhb_:

Click to download the PDB-style file with coordinates for d3dxhb_.
(The format of our PDB-style files is described here.)

Timeline for d3dxhb_: