Lineage for d3dvta_ (3dvt A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188797Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2188798Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2188799Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2188800Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 2188801Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (11 PDB entries)
  8. 2188809Domain d3dvta_: 3dvt A: [174291]
    automated match to d1rhwa_

Details for d3dvta_

PDB Entry: 3dvt (more details), 2.3 Å

PDB Description: Biochemical and structural characterization of the PAK1- LC8 interaction
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3dvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvta_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d3dvta_:

Click to download the PDB-style file with coordinates for d3dvta_.
(The format of our PDB-style files is described here.)

Timeline for d3dvta_: