Lineage for d3dtma_ (3dtm A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690948Species Escherichia coli [TaxId:469008] [188520] (1 PDB entry)
  8. 1690949Domain d3dtma_: 3dtm A: [174219]
    automated match to d1axba_

Details for d3dtma_

PDB Entry: 3dtm (more details), 2 Å

PDB Description: increased folding stability of tem-1 beta-lactamase by in-vitro selection
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3dtma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtma_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrseerfpmmstfkvllcgailsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
kgltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltpasrq
qlmdwmeadkvagpllrsvlpagwfiadksgagergsrgivaalgpdgkpsrivviyttg
sqatmdelnrqiaeigaslikhw

SCOPe Domain Coordinates for d3dtma_:

Click to download the PDB-style file with coordinates for d3dtma_.
(The format of our PDB-style files is described here.)

Timeline for d3dtma_: