| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
| Protein automated matches [190241] (10 species) not a true protein |
| Species Salmonella typhimurium [TaxId:90371] [188554] (2 PDB entries) |
| Domain d3dr6c_: 3dr6 C: [174201] automated match to d2bl1a1 complexed with edo, gol |
PDB Entry: 3dr6 (more details), 1.75 Å
SCOPe Domain Sequences for d3dr6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dr6c_ d.108.1.1 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvseeng
vvtgyasfgdwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmvagi
esqnaasirlhhslgftvtaqmpqvgvkfgrwldltfmqlqldehaapda
Timeline for d3dr6c_: