Lineage for d3dr6a_ (3dr6 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664621Protein automated matches [190241] (10 species)
    not a true protein
  7. 1664671Species Salmonella typhimurium [TaxId:90371] [188554] (2 PDB entries)
  8. 1664672Domain d3dr6a_: 3dr6 A: [174199]
    automated match to d2bl1a1
    complexed with edo, gol

Details for d3dr6a_

PDB Entry: 3dr6 (more details), 1.75 Å

PDB Description: structure of ynca, a putative acetyltransferase from salmonella typhimurium
PDB Compounds: (A:) yncA

SCOPe Domain Sequences for d3dr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr6a_ d.108.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
amtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvseen
gvvtgyasfgdwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmvag
iesqnaasirlhhslgftvtaqmpqvgvkfgrwldltfmqlqldehaapdac

SCOPe Domain Coordinates for d3dr6a_:

Click to download the PDB-style file with coordinates for d3dr6a_.
(The format of our PDB-style files is described here.)

Timeline for d3dr6a_: