Lineage for d4paxa1 (4pax A:662-796)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712206Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 2712207Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 2712208Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)
  8. 2712213Domain d4paxa1: 4pax A:662-796 [17418]
    Other proteins in same PDB: d4paxa2
    complexed with nu1

Details for d4paxa1

PDB Entry: 4pax (more details), 2.8 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 8-hydroxy-2-methyl-3-hydro-quinazolin-4-one
PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d4paxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4paxa1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus) [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

SCOPe Domain Coordinates for d4paxa1:

Click to download the PDB-style file with coordinates for d4paxa1.
(The format of our PDB-style files is described here.)

Timeline for d4paxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4paxa2