Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries) |
Domain d3dp1a_: 3dp1 A: [174123] automated match to d1u1za_ complexed with 2rb, ben, cl |
PDB Entry: 3dp1 (more details), 2.3 Å
SCOPe Domain Sequences for d3dp1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dp1a_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]} qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh kgmiwqvggtaqvdgkvvaeaelkamiaere
Timeline for d3dp1a_: