Lineage for d3dn8a_ (3dn8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2532819Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2532825Protein Phage T4 lysozyme [53982] (1 species)
  7. 2532826Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2532916Domain d3dn8a_: 3dn8 A: [174075]
    automated match to d212la_
    complexed with bme, cl, hed, ibf, po4; mutant

Details for d3dn8a_

PDB Entry: 3dn8 (more details), 1.7 Å

PDB Description: iodopentafluorobenzene binding in the hydrophobic cavity of t4 lysozyme l99a mutant (seleno version)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3dn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dn8a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d3dn8a_:

Click to download the PDB-style file with coordinates for d3dn8a_.
(The format of our PDB-style files is described here.)

Timeline for d3dn8a_: