Lineage for d3dkud_ (3dku D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923249Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1923250Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1923546Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1923547Protein automated matches [191036] (11 species)
    not a true protein
  7. 1923586Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries)
  8. 1923590Domain d3dkud_: 3dku D: [174044]
    automated match to d2b0va1

Details for d3dkud_

PDB Entry: 3dku (more details), 2.69 Å

PDB Description: crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1
PDB Compounds: (D:) Putative phosphohydrolase

SCOPe Domain Sequences for d3dkud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkud_ d.113.1.0 (D:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfnwpf

SCOPe Domain Coordinates for d3dkud_:

Click to download the PDB-style file with coordinates for d3dkud_.
(The format of our PDB-style files is described here.)

Timeline for d3dkud_: