Lineage for d3djxa_ (3djx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928492Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2928575Domain d3djxa_: 3djx A: [174012]
    automated match to d11baa_
    complexed with c5p

Details for d3djxa_

PDB Entry: 3djx (more details), 1.69 Å

PDB Description: bovine seminal ribonuclease- cytidine 5' phosphate complex
PDB Compounds: (A:) Seminal ribonuclease

SCOPe Domain Sequences for d3djxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3djxa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d3djxa_:

Click to download the PDB-style file with coordinates for d3djxa_.
(The format of our PDB-style files is described here.)

Timeline for d3djxa_: