Lineage for d3dgib_ (3dgi B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1094885Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 1094886Species Bacillus megaterium [TaxId:1404] [48269] (45 PDB entries)
    Uniprot P14779
  8. 1094928Domain d3dgib_: 3dgi B: [173928]
    automated match to d1bu7a_
    complexed with dms, hem; mutant

Details for d3dgib_

PDB Entry: 3dgi (more details), 1.95 Å

PDB Description: crystal structure of f87a/t268a mutant of cyp bm3
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d3dgib_:

Sequence, based on SEQRES records: (download)

>d3dgib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglatswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliagheatsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d3dgib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglatswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrafq
edikvmndlvdkiiadrkasddllthmlngkdpetgeplddeniryqiitfliagheats
gllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlnealrlwptapa
fslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfenpsaipqhaf
kpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltlkpegfvvkaks
kkipl

SCOPe Domain Coordinates for d3dgib_:

Click to download the PDB-style file with coordinates for d3dgib_.
(The format of our PDB-style files is described here.)

Timeline for d3dgib_: