SCOPe 2.06: Domain d2cpoa1: 2cpo A:0-119

Lineage for d2cpoa1 (2cpo A:0-119)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.3: Cloroperoxidase [47571] (1 family)
   duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each

5. Family a.39.3.1: Cloroperoxidase [47572] (1 protein)

6. Protein Cloroperoxidase [47573] (1 species)

7. Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)

8. Domain d2cpoa1: 2cpo A:0-119 [17392]
   complexed with hem, man, mn, nag

Details for d2cpoa1

PDB Entry: 2cpo, 2.1 Å

PDB Description: chloroperoxidase

PDB Compounds: (A:) chloroperoxidase

SCOPe Domain Sequences for d2cpoa1:

Sequence; same for both SEQRES and ATOM records:

>d2cpoa1 a.39.3.1 (A:0-119) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva

Timeline for d2cpoa1:

• d2cpoa1 first appeared (with stable ids) in SCOP 1.55, called d2cpo_1
  
• d2cpoa1 appears in SCOPe 2.05
  
• d2cpoa1 appears in SCOPe 2.07
  
• d2cpoa1 appears in the current release, SCOPe 2.08