Lineage for d3dfef_ (3dfe F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193923Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2194218Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2194219Protein automated matches [190753] (16 species)
    not a true protein
  7. 2194220Species Anabaena variabilis [TaxId:240292] [188517] (1 PDB entry)
  8. 2194226Domain d3dfef_: 3dfe F: [173891]
    automated match to d2cz4a1
    complexed with edo, ipa

Details for d3dfef_

PDB Entry: 3dfe (more details), 2.35 Å

PDB Description: crystal structure of a putative pii-like signaling protein (yp_323533.1) from anabaena variabilis atcc 29413 at 2.35 a resolution
PDB Compounds: (F:) Putative Pii-Like Signaling Protein

SCOPe Domain Sequences for d3dfef_:

Sequence, based on SEQRES records: (download)

>d3dfef_ d.58.5.0 (F:) automated matches {Anabaena variabilis [TaxId: 240292]}
kranklvivtekvllkkvakiieeagatgytvvdtggkgsrnvrstgkpntsdtdsnvkf
evltenremaekiadqvaikfftdyagiiyiceaevlyg

Sequence, based on observed residues (ATOM records): (download)

>d3dfef_ d.58.5.0 (F:) automated matches {Anabaena variabilis [TaxId: 240292]}
kranklvivtekvllkkvakiieeagatgytvvdtggnvkfevltenremaekiadqvai
kfftdyagiiyiceaevlyg

SCOPe Domain Coordinates for d3dfef_:

Click to download the PDB-style file with coordinates for d3dfef_.
(The format of our PDB-style files is described here.)

Timeline for d3dfef_: