SCOP 1.57: Domain d1dqea_: 1dqe A:

Lineage for d1dqea_ (1dqe A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.39: EF Hand-like [47472] (3 superfamilies)

4. Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family)

5. Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)

6. Protein Pheromone binding protein [47569] (1 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (1 PDB entry)

8. Domain d1dqea_: 1dqe A: [17388]

Details for d1dqea_

PDB Entry: 1dqe, 1.8 Å

PDB Description: bombyx mori pheromone binding protein

SCOP Domain Sequences for d1dqea_:

Sequence; same for both SEQRES and ATOM records:

>d1dqea_ a.39.2.1 (A:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

Timeline for d1dqea_:

• d1dqea_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqea_ appears in SCOP 1.59
  
• d1dqea_ appears in the current release, SCOPe 2.08