SCOPe 2.08: Domain d1dqea_: 1dqe A:

Lineage for d1dqea_ (1dqe A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)

8. Domain d1dqea_: 1dqe A: [17388]
   complexed with bom

Details for d1dqea_

PDB Entry: 1dqe, 1.8 Å

PDB Description: bombyx mori pheromone binding protein

PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1dqea_:

Sequence; same for both SEQRES and ATOM records:

>d1dqea_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

Timeline for d1dqea_:

• d1dqea_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqea_ appears in SCOPe 2.07