Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Chlamydia trachomatis [TaxId:813] [188892] (1 PDB entry) |
Domain d3delc1: 3del C:34-257 [173869] Other proteins in same PDB: d3delb2, d3delc2, d3deld2, d3delf2 automated match to d1hpbp_ |
PDB Entry: 3del (more details), 1.92 Å
SCOPe Domain Sequences for d3delc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3delc1 c.94.1.0 (C:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]} ekfivgtnatyppfefvdkrgevvgfdidlareisnklgktldvrefsfdalilnlkqhr idavitgmsitpsrlkeilmipyygeeikhlvlvfkgenkhplpltqyrsvavqtgtyqe aylqslsevhirsfdstlevlmevmhgkspvavlepsiaqvvlkdfpalstatidlpedq wvlgygigvasdrpalalkieaavqeirkegvlaeleqkwglnn
Timeline for d3delc1: