Lineage for d3de8d_ (3de8 D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083319Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 1083320Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
  6. 1083331Protein automated matches [190502] (1 species)
    not a true protein
  7. 1083332Species Escherichia coli [TaxId:562] [187450] (25 PDB entries)
  8. 1083336Domain d3de8d_: 3de8 D: [173864]
    automated match to d1qq3a_
    complexed with ca, cu, hem

Details for d3de8d_

PDB Entry: 3de8 (more details), 1.72 Å

PDB Description: crystal structure of a dimeric cytochrome cb562 assembly induced by copper coordination
PDB Compounds: (D:) Soluble cytochrome b562

SCOPe Domain Sequences for d3de8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3de8d_ a.24.3.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemhd
frhgfdilvgqihdalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3de8d_:

Click to download the PDB-style file with coordinates for d3de8d_.
(The format of our PDB-style files is described here.)

Timeline for d3de8d_: