SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3de6x_ (3de6 X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115188Species Engyodontium album [TaxId:37998] [187057] (27 PDB entries)
  8. 2115211Domain d3de6x_: 3de6 X: [173859]
    automated match to d1bjre_
    complexed with ca

Details for d3de6x_

PDB Entry: 3de6 (more details), 2.2 Å

PDB Description: Proteinase K by Classical hanging drop method after the third step of high X-Ray dose on ESRF ID23-1 beamline
PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d3de6x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3de6x_ c.41.1.1 (X:) automated matches {Engyodontium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3de6x_:

Click to download the PDB-style file with coordinates for d3de6x_.
(The format of our PDB-style files is described here.)

Timeline for d3de6x_: