Lineage for d3dd5d_ (3dd5 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617788Species Glomerella cingulata [TaxId:5457] [188664] (3 PDB entries)
  8. 1617795Domain d3dd5d_: 3dd5 D: [173828]
    automated match to d1cuwa_
    complexed with dep

Details for d3dd5d_

PDB Entry: 3dd5 (more details), 2.6 Å

PDB Description: Glomerella cingulata E600-cutinase complex
PDB Compounds: (D:) cutinase

SCOPe Domain Sequences for d3dd5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dd5d_ c.69.1.0 (D:) automated matches {Glomerella cingulata [TaxId: 5457]}
qsstrneletgsssacpkviyifarastepgnmgisagpivadaleriygandvwvqgvg
gpyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavmagsisgls
ttiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpahflyqtd
aavaaprflqarig

SCOPe Domain Coordinates for d3dd5d_:

Click to download the PDB-style file with coordinates for d3dd5d_.
(The format of our PDB-style files is described here.)

Timeline for d3dd5d_: