Lineage for d3d9qx_ (3d9q X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129455Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2129656Protein automated matches [190073] (15 species)
    not a true protein
  7. 2129718Species Engyodontium album [TaxId:37998] [187057] (27 PDB entries)
  8. 2129724Domain d3d9qx_: 3d9q X: [173771]
    automated match to d1bjre_
    complexed with ca

Details for d3d9qx_

PDB Entry: 3d9q (more details), 1.43 Å

PDB Description: Proteinase K by LB nanotemplate method before high X-Ray dose on ESRF ID23-1 beamline
PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d3d9qx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9qx_ c.41.1.1 (X:) automated matches {Engyodontium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3d9qx_:

Click to download the PDB-style file with coordinates for d3d9qx_.
(The format of our PDB-style files is described here.)

Timeline for d3d9qx_: