Lineage for d3d6xc_ (3d6x C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551439Species Campylobacter jejuni [TaxId:354242] [188866] (1 PDB entry)
  8. 2551442Domain d3d6xc_: 3d6x C: [173727]
    automated match to d1u1za_

Details for d3d6xc_

PDB Entry: 3d6x (more details), 2.59 Å

PDB Description: Crystal structure of Campylobacter jejuni FabZ
PDB Compounds: (C:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d3d6xc_:

Sequence, based on SEQRES records: (download)

>d3d6xc_ d.38.1.0 (C:) automated matches {Campylobacter jejuni [TaxId: 354242]}
midvmqiqeilphrypfllvdkitelkvkevvlgyknisisdhvfmghfpghpiypgvli
legmaqtggvlafesmedkvdpkskvvyftgidgakfrnpvrpgdrldyemsvvknrgnm
wifkgqafvdgnlvaeaelkamivd

Sequence, based on observed residues (ATOM records): (download)

>d3d6xc_ d.38.1.0 (C:) automated matches {Campylobacter jejuni [TaxId: 354242]}
midvmqiqeilphrypfllvdkitelkvkevvlgyknisisdhvfmghfpghpiypgvli
legmaqtggvlafesmpkskvvyftgidgakfrnpvrpgdrldyemsvvknrgnmwifkg
qafvdgnlvaeaelkamivd

SCOPe Domain Coordinates for d3d6xc_:

Click to download the PDB-style file with coordinates for d3d6xc_.
(The format of our PDB-style files is described here.)

Timeline for d3d6xc_: