SCOPe 2.06: Domain d3d55d_: 3d55 D:

Lineage for d3d55d_ (3d55 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (2 families)

5. Family d.306.1.0: automated matches [191570] (1 protein)
   not a true family

6. Protein automated matches [190989] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries)

8. Domain d3d55d_: 3d55 D: [173688]
   automated match to d2a6qa1
   complexed with so4

Details for d3d55d_

PDB Entry: 3d55, 2.13 Å

PDB Description: Crystal structure of M. tuberculosis YefM antitoxin

PDB Compounds: (D:) Uncharacterized protein Rv3357/MT3465

SCOPe Domain Sequences for d3d55d_:

Sequence, based on SEQRES records:

>d3d55d_ d.306.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenar
rlmeavardkaghsaftksvdelremagg

Sequence, based on observed residues (ATOM records):

>d3d55d_ d.306.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenar
rlmeavsaftksvdelremagg

Timeline for d3d55d_:

• d3d55d_ first appeared in SCOPe 2.01
  
• d3d55d_ appears in SCOPe 2.05
  
• d3d55d_ appears in SCOPe 2.07
  
• d3d55d_ appears in the current release, SCOPe 2.08