Lineage for d1aj5b_ (1aj5 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269674Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1269688Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 1269692Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries)
  8. 1269698Domain d1aj5b_: 1aj5 B: [17368]

Details for d1aj5b_

PDB Entry: 1aj5 (more details), 2.3 Å

PDB Description: calpain domain vi apo
PDB Compounds: (B:) calpain

SCOPe Domain Sequences for d1aj5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj5b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1aj5b_:

Click to download the PDB-style file with coordinates for d1aj5b_.
(The format of our PDB-style files is described here.)

Timeline for d1aj5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aj5a_