Lineage for d1aj5b_ (1aj5 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins) Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (3 PDB entries) 
Domain d1aj5b_: 1aj5 B: [17368]
Details for d1aj5b_
PDB Entry: 1aj5 (more details), 2.3 Å
PDB Description: calpain domain vi apo
SCOP Domain Sequences for d1aj5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aj5b_ a.39.1.7 (B:) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus)}
eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
SCOP Domain Coordinates for d1aj5b_:
Click to download the PDB-style file with coordinates for d1aj5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aj5b_:
- d1aj5b_ appears in SCOP 1.57
- d1aj5b_ appears in the current release, SCOPe 2.08
View in 3D
