SCOPe 2.04: Domain d3d3tb_: 3d3t B:

Lineage for d3d3tb_ (3d3t B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (42 PDB entries)

8. Domain d3d3tb_: 3d3t B: [173664]
   automated match to d1a8ga_

Details for d3d3tb_

PDB Entry: 3d3t, 2.8 Å

PDB Description: crystal structure of hiv-1 crf01_ae in complex with the substrate p1- p6

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d3d3tb_:

Sequence; same for both SEQRES and ATOM records:

>d3d3tb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf

Timeline for d3d3tb_:

• d3d3tb_ first appeared in SCOPe 2.01
  
• d3d3tb_ appears in SCOPe 2.03
  
• d3d3tb_ appears in SCOPe 2.05
  
• d3d3tb_ appears in the current release, SCOPe 2.08