SCOPe 2.03: Domain d3czva_: 3czv A:

Lineage for d3czva_ (3czv A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (14 PDB entries)

8. Domain d3czva_: 3czv A: [173565]
   automated match to d1huga_
   complexed with azm, gol, zn

Details for d3czva_

PDB Entry: 3czv, 2 Å

PDB Description: Crystal structure of the human carbonic anhydrase XIII in complex with acetazolamide

PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d3czva_:

Sequence; same for both SEQRES and ATOM records:

>d3czva_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

Timeline for d3czva_:

• d3czva_ first appeared in SCOPe 2.01
  
• d3czva_ appears in SCOPe 2.02
  
• d3czva_ appears in SCOPe 2.04
  
• d3czva_ appears in the current release, SCOPe 2.08