Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) |
Protein automated matches [190681] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187805] (10 PDB entries) |
Domain d3czva_: 3czv A: [173565] automated match to d1huga_ complexed with azm, gol, zn |
PDB Entry: 3czv (more details), 2 Å
SCOPe Domain Sequences for d3czva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czva_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs nhrppqplkgrkvrasfh
Timeline for d3czva_: