Lineage for d3czva_ (3czv A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961969Protein automated matches [190681] (1 species)
    not a true protein
  7. 961970Species Human (Homo sapiens) [TaxId:9606] [187805] (10 PDB entries)
  8. 961976Domain d3czva_: 3czv A: [173565]
    automated match to d1huga_
    complexed with azm, gol, zn

Details for d3czva_

PDB Entry: 3czv (more details), 2 Å

PDB Description: Crystal structure of the human carbonic anhydrase XIII in complex with acetazolamide
PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d3czva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czva_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasfh

SCOPe Domain Coordinates for d3czva_:

Click to download the PDB-style file with coordinates for d3czva_.
(The format of our PDB-style files is described here.)

Timeline for d3czva_: