SCOPe 2.04: Domain d3cx6b_: 3cx6 B:

Lineage for d3cx6b_ (3cx6 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein automated matches [190756] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188643] (3 PDB entries)

8. Domain d3cx6b_: 3cx6 B: [173524]
   automated match to d1htjf_
   complexed with gdp, mg

Details for d3cx6b_

PDB Entry: 3cx6, 2.5 Å

PDB Description: crystal structure of pdzrhogef rgrgs domain in a complex with galpha- 13 bound to gdp

PDB Compounds: (B:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d3cx6b_:

Sequence, based on SEQRES records:

>d3cx6b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
liigpeedydpgyfnnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevy
qqtnpkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavm
leiqeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrs
apmdfavntfmshagi

Sequence, based on observed residues (ATOM records):

>d3cx6b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
liigpeeesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevyqqtnpksrs
lgkdiwnifleknaplrvkipemlqaeidlrrnnedprnvlceaqeavmleiqeqindyr
skrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrsapmdfavntfm
shagi

Timeline for d3cx6b_:

• d3cx6b_ first appeared in SCOPe 2.01
  
• d3cx6b_ appears in SCOPe 2.03
  
• d3cx6b_ appears in SCOPe 2.05
  
• d3cx6b_ appears in the current release, SCOPe 2.08