Lineage for d3cuia_ (3cui A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1146191Protein Xylanase A, catalytic core [51514] (8 species)
  7. 1146192Species Cellulomonas fimi [TaxId:1708] [51520] (14 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 1146193Domain d3cuia_: 3cui A: [173470]
    automated match to d1expa_
    complexed with x4s

Details for d3cuia_

PDB Entry: 3cui (more details), 1.5 Å

PDB Description: cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
PDB Compounds: (A:) Exo-beta-1,4-glucanase

SCOPe Domain Sequences for d3cuia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cuia_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeafga

SCOPe Domain Coordinates for d3cuia_:

Click to download the PDB-style file with coordinates for d3cuia_.
(The format of our PDB-style files is described here.)

Timeline for d3cuia_: