Lineage for d1djhb1 (1djh B:158-298)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1088531Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 1088566Protein Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) [47548] (1 species)
  7. 1088567Species Norway rat (Rattus norvegicus) [TaxId:10116] [47549] (10 PDB entries)
  8. 1088575Domain d1djhb1: 1djh B:158-298 [17347]
    Other proteins in same PDB: d1djha2, d1djha3, d1djhb2, d1djhb3
    complexed with act, ba

Details for d1djhb1

PDB Entry: 1djh (more details), 2.5 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with barium
PDB Compounds: (B:) phosphoinositide-specific phospholipase c, isozyme delta1

SCOPe Domain Sequences for d1djhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djhb1 a.39.1.7 (B:158-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nkmnfkelkdflkelniqvddgyarkifrecdhsqtdsledeeietfykmltqraeidra
feeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetakaqrqmtkdgflm
yllsadgnafslahrrvyqdm

SCOPe Domain Coordinates for d1djhb1:

Click to download the PDB-style file with coordinates for d1djhb1.
(The format of our PDB-style files is described here.)

Timeline for d1djhb1: