| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.306: YefM-like [143119] (1 superfamily) core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet; |
Superfamily d.306.1: YefM-like [143120] (2 families) ![]() |
| Family d.306.1.0: automated matches [191570] (1 protein) not a true family |
| Protein automated matches [190989] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries) |
| Domain d3ctob_: 3cto B: [173459] Other proteins in same PDB: d3ctoe_ automated match to d2a6qa1 complexed with so4 |
PDB Entry: 3cto (more details), 2.5 Å
SCOPe Domain Sequences for d3ctob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ctob_ d.306.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaghsaftksvdelr
Timeline for d3ctob_:
View in 3DDomains from other chains: (mouse over for more information) d3ctoa_, d3ctoc_, d3ctod_, d3ctoe_ |