Lineage for d3ctob_ (3cto B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242423Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 2242424Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 2242438Family d.306.1.0: automated matches [191570] (1 protein)
    not a true family
  6. 2242439Protein automated matches [190989] (1 species)
    not a true protein
  7. 2242440Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries)
  8. 2242454Domain d3ctob_: 3cto B: [173459]
    Other proteins in same PDB: d3ctoe_
    automated match to d2a6qa1
    complexed with so4

Details for d3ctob_

PDB Entry: 3cto (more details), 2.5 Å

PDB Description: Crystal Structure of M. tuberculosis YefM antitoxin
PDB Compounds: (B:) Uncharacterized protein Rv3357/MT3465

SCOPe Domain Sequences for d3ctob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ctob_ d.306.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaghsaftksvdelr

SCOPe Domain Coordinates for d3ctob_:

Click to download the PDB-style file with coordinates for d3ctob_.
(The format of our PDB-style files is described here.)

Timeline for d3ctob_: