SCOPe 2.04: Domain d3csea_: 3cse A:

Lineage for d3csea_ (3cse A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:5478] [188672] (1 PDB entry)

8. Domain d3csea_: 3cse A: [173432]
   automated match to d1ai9a_
   complexed with n22, ndp

Details for d3csea_

PDB Entry: 3cse, 1.6 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 2,4- diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3csea_:

Sequence; same for both SEQRES and ATOM records:

>d3csea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3csea_:

• d3csea_ first appeared in SCOPe 2.01
  
• d3csea_ appears in SCOPe 2.03
  
• d3csea_ appears in SCOPe 2.05
  
• d3csea_ appears in the current release, SCOPe 2.08, called d3csea1