Lineage for d3cprb_ (3cpr B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972171Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 972300Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 972320Species Corynebacterium glutamicum [TaxId:1718] [188663] (1 PDB entry)
  8. 972322Domain d3cprb_: 3cpr B: [173394]
    automated match to d1xxxb1

Details for d3cprb_

PDB Entry: 3cpr (more details), 2.2 Å

PDB Description: the crystal structure of corynebacterium glutamicum dihydrodipicolinate synthase to 2.2 a resolution
PDB Compounds: (B:) Dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3cprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cprb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Corynebacterium glutamicum [TaxId: 1718]}
itstgltaktgvehfgtvgvamvtpftesgdidiaagrevaaylvdkgldslvlagttge
sptttaaeklellkavreevgdrakliagvgtnntrtsvelaeaaasagadgllvvtpyy
skpsqegllahfgaiaaatevpiclydipgrsgipiesdtmrrlselptilavkdakgdl
vaatsliketglawysgddplnlvwlalggsgfisvighaaptalrelytsfeegdlvra
reinaklsplvaaqgrlggvslakaalrlqginvgdprlpimapneqelealredmkkag
vl

SCOPe Domain Coordinates for d3cprb_:

Click to download the PDB-style file with coordinates for d3cprb_.
(The format of our PDB-style files is described here.)

Timeline for d3cprb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cpra_