SCOPe 2.02: Domain d3cnqs_: 3cnq S:

Lineage for d3cnqs_ (3cnq S:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein Subtilisin [52745] (6 species)

7. Species Bacillus amyloliquefaciens, Novo/BPN' [TaxId:1390] [52751] (54 PDB entries)
   Uniprot P00782 108-382

8. Domain d3cnqs_: 3cnq S: [173359]
   Other proteins in same PDB: d3cnqp_
   automated match to d1gnva_
   complexed with zn

Details for d3cnqs_

PDB Entry: 3cnq, 1.71 Å

PDB Description: prosubtilisin substrate complex of subtilisin subt_bacam

PDB Compounds: (S:) subtilisin bpn'

SCOPe Domain Sequences for d3cnqs_:

Sequence; same for both SEQRES and ATOM records:

>d3cnqs_ c.41.1.1 (S:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}
cvsygvaqikapalhsqgytgsnvkvavlasgidsshpdlnvaggasfvpsetnpfqdnn
shgthvagtvlavapsaslyavkvlgadgsgqaswiingiewaiannmdvinmslgspsg
saalkaavdkavasgvvvvaaagnsgtsgssstvsypakypsviavgavdssnqrapfss
vgpeldvmapgvsicstlpggkygalsgtamasphvagaaalilskhpnwtntqvrssle
ntatklgdsfyygkglinveaaaq

Timeline for d3cnqs_:

• d3cnqs_ first appeared in SCOPe 2.01
  
• d3cnqs_ appears in SCOPe 2.03
  
• d3cnqs_ appears in the current release, SCOPe 2.08