Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (2 species) not a true protein |
Species Enterobacter sp. [TaxId:211595] [189872] (2 PDB entries) |
Domain d3clcd_: 3clc D: [173312] automated match to d2b5ad1 protein/DNA complex; complexed with mg |
PDB Entry: 3clc (more details), 2.8 Å
SCOPe Domain Sequences for d3clcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3clcd_ a.35.1.0 (D:) automated matches {Enterobacter sp. [TaxId: 211595]} esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle vsdvvffemlikeilk
Timeline for d3clcd_: