SCOPe 2.04: Domain d3cglc_: 3cgl C:

Lineage for d3cglc_ (3cgl C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Discosoma striata [188537] (1 PDB entry)

8. Domain d3cglc_: 3cgl C: [173226]
   automated match to d1mova_
   complexed with na

Details for d3cglc_

PDB Entry: 3cgl, 2.09 Å

PDB Description: crystal structure and raman studies of dsfp483, a cyan fluorescent protein from discosoma striata

PDB Compounds: (C:) GFP-like fluorescent chromoprotein dsFP483

SCOPe Domain Sequences for d3cglc_:

Sequence; same for both SEQRES and ATOM records:

>d3cglc_ d.22.1.1 (C:) automated matches {Discosoma striata}
svikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqf
qygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikft
glnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakk
aalkmpgyhyvdtklviwnndkefmkveeheiavarhhpfyep

Timeline for d3cglc_:

• d3cglc_ first appeared in SCOPe 2.01
  
• d3cglc_ appears in SCOPe 2.03
  
• d3cglc_ appears in SCOPe 2.05
  
• d3cglc_ appears in the current release, SCOPe 2.08