Lineage for d3cg4a_ (3cg4 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356506Species Methanospirillum hungatei [TaxId:323259] [188365] (2 PDB entries)
  8. 1356509Domain d3cg4a_: 3cg4 A: [173219]
    automated match to d1zesb1
    complexed with gol, mg

Details for d3cg4a_

PDB Entry: 3cg4 (more details), 1.61 Å

PDB Description: crystal structure of response regulator receiver domain protein (chey- like) from methanospirillum hungatei jf-1
PDB Compounds: (A:) Response regulator receiver domain protein (CheY-like)

SCOPe Domain Sequences for d3cg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cg4a_ c.23.1.0 (A:) automated matches {Methanospirillum hungatei [TaxId: 323259]}
hkgdvmivdddahvriavktilsdagfhiisadsggqcidllkkgfsgvvlldimmpgmd
gwdtiraildnsleqgiaivmltaknapdakmiglqeyvvdyitkpfdnedliekttffm
gfvrnq

SCOPe Domain Coordinates for d3cg4a_:

Click to download the PDB-style file with coordinates for d3cg4a_.
(The format of our PDB-style files is described here.)

Timeline for d3cg4a_: