SCOPe 2.01: Domain d3cg3a_: 3cg3 A:

Lineage for d3cg3a_ (3cg3 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (20 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188797] (1 PDB entry)

8. Domain d3cg3a_: 3cg3 A: [173218]
   automated match to d2onke1
   complexed with wo4

Details for d3cg3a_

PDB Entry: 3cg3, 1.8 Å

PDB Description: Crystal structure of P. horikoshii periplasmic binding protein ModA/WtpA with bound tungstate

PDB Compounds: (A:) UPF0100 protein PH0151

SCOPe Domain Sequences for d3cg3a_:

Sequence; same for both SEQRES and ATOM records:

>d3cg3a_ c.94.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
srearliifhagslsiplsqveekftkyaqeklgvkvtfqdeasgsvkavrkvtdlkkra
divavadytlipqlmipnytdfyvlfatneiviaftnkskyademlknpdkwyeilsrpd
vsfgfsdpnqdpcgyrsvmvmklaelyygrpifkelvekttniysngtriyapkeiiikd
krvimrpketdlvglvesgsldyifiyksvakqhhlsyitlpddinlgdfnkadfygrvs
itlgstgktikakpivygitvlknapnrelaieflrfllgnegrkifednyqeflsppva
fgnvppeirrlvevk

Timeline for d3cg3a_:

• d3cg3a_ is new in SCOPe 2.01-stable
  
• d3cg3a_ appears in SCOPe 2.02
  
• d3cg3a_ appears in the current release, SCOPe 2.08