SCOPe 2.07: Domain d3cbza1: 3cbz A:264-367

Lineage for d3cbza1 (3cbz A:264-367)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 protein domains)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d3cbza1: 3cbz A:264-367 [173126]
   Other proteins in same PDB: d3cbza2
   automated match to d1l6oc_
   complexed with edo, po4

Details for d3cbza1

PDB Entry: 3cbz, 1.38 Å

PDB Description: the dvl2 pdz domain in complex with the n2 inhibitory peptide

PDB Compounds: (A:) Dishevelled-2

SCOPe Domain Sequences for d3cbza1:

Sequence, based on SEQRES records:

>d3cbza1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggsgnevwidgp

Sequence, based on observed residues (ATOM records):

>d3cbza1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksggsgnevwidgp

Timeline for d3cbza1:

• d3cbza1 first appeared in SCOPe 2.01, called d3cbza_
  
• d3cbza1 appears in SCOPe 2.06