SCOPe 2.06: Domain d3cbya1: 3cby A:264-367

Lineage for d3cbya1 (3cby A:264-367)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d3cbya1: 3cby A:264-367 [173124]
   Other proteins in same PDB: d3cbya2
   automated match to d1l6oa_
   complexed with edo

Details for d3cbya1

PDB Entry: 3cby, 1.5 Å

PDB Description: the dvl2 pdz domain in complex with the n1 inhibitory peptide

PDB Compounds: (A:) Dishevelled-2

SCOPe Domain Sequences for d3cbya1:

Sequence, based on SEQRES records:

>d3cbya1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggwkdygwidgk

Sequence, based on observed residues (ATOM records):

>d3cbya1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqggiyigsimkggavaadgriepgdmllqvndmnfenms
nddavrvlrdivhkpgpivltvaksgggwkdygwidgk

Timeline for d3cbya1:

• d3cbya1 first appeared in SCOPe 2.01, called d3cbya_
  
• d3cbya1 was called d3cbya_ in SCOPe 2.05
  
• d3cbya1 appears in SCOPe 2.07
  
• d3cbya1 appears in the current release, SCOPe 2.08