Lineage for d3cbxb1 (3cbx B:264-364)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786081Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2786090Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)
  8. 2786096Domain d3cbxb1: 3cbx B:264-364 [173123]
    Other proteins in same PDB: d3cbxa2, d3cbxb2
    automated match to d1l6oa_
    complexed with cl, mpd

Details for d3cbxb1

PDB Entry: 3cbx (more details), 1.7 Å

PDB Description: the dvl2 pdz domain in complex with the c1 inhibitory peptide
PDB Compounds: (B:) Dishevelled-2

SCOPe Domain Sequences for d3cbxb1:

Sequence, based on SEQRES records: (download)

>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf

Sequence, based on observed residues (ATOM records): (download)

>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm
snddavrvlrdivhkpgpivltvaksgggwkwygwf

SCOPe Domain Coordinates for d3cbxb1:

Click to download the PDB-style file with coordinates for d3cbxb1.
(The format of our PDB-style files is described here.)

Timeline for d3cbxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cbxb2