![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries) |
![]() | Domain d3cbxb1: 3cbx B:264-364 [173123] Other proteins in same PDB: d3cbxa2, d3cbxb2 automated match to d1l6oa_ complexed with cl, mpd |
PDB Entry: 3cbx (more details), 1.7 Å
SCOPe Domain Sequences for d3cbxb1:
Sequence, based on SEQRES records: (download)
>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]} niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm nfenmsnddavrvlrdivhkpgpivltvaksgggwkwygwf
>d3cbxb1 b.36.1.1 (B:264-364) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]} niitvtlnmekynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm snddavrvlrdivhkpgpivltvaksgggwkwygwf
Timeline for d3cbxb1: