Lineage for d3c3dd_ (3c3d D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012940Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 1012941Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 1012942Family c.143.1.1: CofD-like [142339] (3 proteins)
    Pfam PF01933; UPF0052
  6. 1012949Protein LPPG:FO 2-phospho-L-lactate transferase CofD [142340] (1 species)
  7. 1012950Species Methanosarcina mazei [TaxId:2209] [142341] (2 PDB entries)
    Uniprot Q8PVT6 1-309
  8. 1012954Domain d3c3dd_: 3c3d D: [173017]
    automated match to d2ffea1
    complexed with fo1, po4

Details for d3c3dd_

PDB Entry: 3c3d (more details), 2.5 Å

PDB Description: Crystal structure of 2-phospho-(S)-lactate transferase from Methanosarcina mazei in complex with Fo and phosphate. Northeast Structural Genomics Consortium target MaR46
PDB Compounds: (D:) 2-phospho-L-lactate transferase

SCOPe Domain Sequences for d3c3dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3dd_ c.143.1.1 (D:) LPPG:FO 2-phospho-L-lactate transferase CofD {Methanosarcina mazei [TaxId: 2209]}
miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidr
krwwgiendtfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslf
gikanilpmsddpvstyietaegimhfqdfwigkrgepdvrgvdirgvseasispkvlea
fekeeniligpsnpitsigpiislpgmrellkkkkvvavspiignapvsgpagklmpacg
ievssmgvaeyyqdfldvfvfderdradefaferlgchasradtlmtstekskelaeivv
qafleh

SCOPe Domain Coordinates for d3c3dd_:

Click to download the PDB-style file with coordinates for d3c3dd_.
(The format of our PDB-style files is described here.)

Timeline for d3c3dd_: