SCOPe 2.07: Domain d3c1lj_: 3c1l J:

Lineage for d3c1lj_ (3c1l J:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein automated matches [190902] (2 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [188336] (1 PDB entry)

8. Domain d3c1lj_: 3c1l J: [172995]
   automated match to d2pfxa1
   complexed with cl, peg

Details for d3c1lj_

PDB Entry: 3c1l, 2 Å

PDB Description: crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution

PDB Compounds: (J:) Putative antioxidant defense protein Mlr4105

SCOPe Domain Sequences for d3c1lj_:

Sequence, based on SEQRES records:

>d3c1lj_ a.152.1.3 (J:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gkisaldlasgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlges
glskldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtam
lefavklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndey
hamar

Sequence, based on observed residues (ATOM records):

>d3c1lj_ a.152.1.3 (J:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gkisaldlgelseptkayfakceeklglvpnvlkayafddkklraftdiyndlmlgesgl
skldremiavavssinhcyycltahgaavrqlsgdpalgemlvmnfraadlsprqtamle
favklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrvaaaidmrpndeyha
mar

Timeline for d3c1lj_:

• d3c1lj_ first appeared in SCOPe 2.01
  
• d3c1lj_ appears in SCOPe 2.06
  
• d3c1lj_ appears in the current release, SCOPe 2.08