Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
Protein automated matches [191005] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:32046] [188750] (2 PDB entries) |
Domain d3bz1u_: 3bz1 U: [172951] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1v_, d3bz1x_, d3bz1z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1u_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d3bz1u_: