Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein automated matches [191003] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries) |
Domain d3bz1l_: 3bz1 L: [172948] Other proteins in same PDB: d3bz1a_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1j_, d3bz1m_, d3bz1o_, d3bz1u_, d3bz1v_ automated match to d2axtl1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d3bz1l_: