Lineage for d1dmo__ (1dmo -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (16 proteins) Protein Calmodulin [47516] (7 species) 
Species African frog (Xenopus laevis) [TaxId:8355] [47521] (9 PDB entries) 
Domain d1dmo__: 1dmo - [17293]
Details for d1dmo__
PDB Entry: 1dmo (more details)
PDB Description: calmodulin, nmr, 30 structures
SCOP Domain Sequences for d1dmo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dmo__ a.39.1.5 (-) Calmodulin {African frog (Xenopus laevis)}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
vdemireanidgdgqvnyeefvqmmtak
SCOP Domain Coordinates for d1dmo__:
Click to download the PDB-style file with coordinates for d1dmo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dmo__:
- d1dmo__ first appeared (with stable ids) in SCOP 1.55
- d1dmo__ appears in SCOP 1.59
- d1dmo__ appears in SCOP 1.63
- d1dmo__ appears in the current release, SCOPe 2.08, called d1dmoa_
View in 3D