Lineage for d3bx4c_ (3bx4 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682506Protein automated matches [190329] (7 species)
    not a true protein
  7. 1682507Species Agkistrodon rhodostoma [TaxId:8717] [188575] (1 PDB entry)
  8. 1682510Domain d3bx4c_: 3bx4 C: [172892]
    automated match to d1y17a1
    complexed with gol, so4

Details for d3bx4c_

PDB Entry: 3bx4 (more details), 1.7 Å

PDB Description: Crystal structure of the snake venom toxin aggretin
PDB Compounds: (C:) Aggretin alpha chain

SCOPe Domain Sequences for d3bx4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx4c_ d.169.1.1 (C:) automated matches {Agkistrodon rhodostoma [TaxId: 8717]}
edcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqkd
eladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvnyy
ceqmhafvckllpy

SCOPe Domain Coordinates for d3bx4c_:

Click to download the PDB-style file with coordinates for d3bx4c_.
(The format of our PDB-style files is described here.)

Timeline for d3bx4c_: