SCOPe 2.03: Domain d3bw1a_: 3bw1 A:

Lineage for d3bw1a_ (3bw1 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (4 PDB entries)

8. Domain d3bw1a_: 3bw1 A: [172872]
   automated match to d1i81d_
   complexed with mpd, so4

Details for d3bw1a_

PDB Entry: 3bw1, 2.5 Å

PDB Description: crystal structure of homomeric yeast lsm3 exhibiting novel octameric ring organisation

PDB Compounds: (A:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d3bw1a_:

Sequence, based on SEQRES records:

>d3bw1a_ b.38.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsedddgavei

Sequence, based on observed residues (ATOM records):

>d3bw1a_ b.38.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsavei

Timeline for d3bw1a_:

• d3bw1a_ first appeared in SCOPe 2.01
  
• d3bw1a_ appears in SCOPe 2.02
  
• d3bw1a_ appears in SCOPe 2.04
  
• d3bw1a_ appears in the current release, SCOPe 2.08, called d3bw1a1